PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Ctg06296g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HSF
Protein Properties Length: 121aa    MW: 13848.5 Da    PI: 4.3042
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Ctg06296g00002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.33e-2563121260
                               HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
              HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                               Flkk++e+++d++++++isws+++ sfvv+d+++f+ ++Lpk+Fkh+nf+SF+RQLn+Y
  Niben101Ctg06296g00002.1  63 FLKKTFEMVDDPNTDSIISWSNTKASFVVWDPHKFSIDILPKHFKHNNFSSFIRQLNTY 121
                               9********************999**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.105.7E-2757121IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467852.0E-2359121IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.2E-1659121IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.2E-166386IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.3E-2163121IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.2E-16101113IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.2E-16114121IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MEQEKMVTDD VINGGLQTVK EEPVLFLDEE DDTITTNNGV DEFSSSILPK PLEGLRDMGP  60
PPFLKKTFEM VDDPNTDSII SWSNTKASFV VWDPHKFSID ILPKHFKHNN FSSFIRQLNT  120
Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B6e-18611212787Heat shock factor protein 1
5d5v_B6e-18611212787Heat shock factor protein 1
5d5v_D6e-18611212787Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802448.19e-71PREDICTED: heat stress transcription factor A-2-like
RefseqXP_009802449.19e-71PREDICTED: heat stress transcription factor A-2-like
SwissprotO809821e-35HSFA2_ARATH; Heat stress transcription factor A-2
TrEMBLM1D6702e-50M1D670_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000827525e-50(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56812235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.18e-37heat shock transcription factor A2